GTF2B Antibody - N-terminal region

Description of Target: GTF2B is the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2B.

Key Reference: Tubon,T.C., et al., (2004) Mol. Cell. Biol. 24 (7), 2863-2874.

Molecular Weight: 35kDa.

Peptide Sequence: Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK.

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Transcription initiation factor IIB.

Protein Size: 316.

Purification: Protein A purified.

• Artikelnummer: AVIP100990_T100-25
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: P100990_T100-25
• Verpackungseinheit: 25µl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 2959
• Wirt: Rabbit