NUCB1 Antibody - C-terminal region

NUCB1 Antibody - C-terminal region
Artikelnummer
AVIP102230_P050-25
Verpackungseinheit
25µl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Description of Target: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUCB1.

Key Reference: de Alba,E. et al., (2004) Biochemistry 43 (31), 10039-10049.

Molecular Weight: 54kDa.

Peptide Sequence: Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL.

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Nucleobindin-1.

Protein Size: 461.

Purification: Affinity Purified.

Mehr Informationen
Artikelnummer AVIP102230_P050-25
Hersteller Aviva Systems Biology
Hersteller Artikelnummer P102230_P050-25
Verpackungseinheit 25µl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4924
Wirt Rabbit
Produktinformation (PDF)
×
MSDS (PDF)
×