Mpp2 Antibody - C-terminal region : HRP

Mpp2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56633_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mpp2 is a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mpp2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), isoform CRA_a EMBL EDM06167.1

Protein Size: 552

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56633_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56633_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 85275
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×