Recombinant Human CEBPE Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15744

Gene Name: CEBPE

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Asn201

End Site: Ala270

Coverage: 0.28

Isoelectric Point: 11

Core Sequence: NKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: CCAAT/enhancer-binding protein epsilon; C/EBP epsilon

Protein name: CCAAT enhancer binding protein epsilon

Full length: 281 amino acids

Entry name: CEBPE_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-4048-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4048-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1053