Recombinant Human GMFG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60234

Gene Name: GMFG

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Arg142

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 92%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Glia maturation factor gamma; GMF-gamma

Protein name: glia maturation factor gamma

Full length: 142 amino acids

Entry name: GMFG_HUMAN

• Artikelnummer: ASBPP-4085-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4085-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 9535