C6orf182 Antibody - middle region : HRP

C6orf182 Antibody - middle region : HRP
SKU
AVIARP55720_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of C6orf182 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf182

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVEREKNMILEQQAQLQREKEQDQMKLYAKLEKLDVLEKECFRLTTTQK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein CEP57L1

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP55720_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55720_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285753
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×