Recombinant Human RAB21 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UL25

Gene Name: RAB21

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp91

End Site: Gly220

Coverage: 0.59

Isoelectric Point: 6.5

Core Sequence: DSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0118

Alternative protein names: Ras-related protein Rab-21

Protein name: RAB21, member RAS oncogene family

Full length: 225 amino acids

Entry name: RAB21_HUMAN

• SKU: ASBPP-4043-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4043-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23011