Recombinant Human RD3L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0DJH9

Gene Name: RD3L

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Arg41

End Site: Arg180

Coverage: 0.72

Isoelectric Point: 5.5

Core Sequence: RERLIQEIENEQKVKKTGVDYNWLRNYQNPHTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Pig - 80%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Protein RD3-like; Retinal degeneration protein 3-like

Protein name: RD3 like

Full length: 198 amino acids

Entry name: RD3L_HUMAN

• SKU: ASBPP-4064-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4064-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 647286