Research Areas: Others
Uniprot: P04537
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: Tag-Free
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 15.8 kDa
Gene Names: uvsY
Organism: Enterobacteria phage T4 (Bacteriophage T4)
Source: E.coli
Expression Region: 1-137aa
Protein Length: Full Length
Target Protein Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Endotoxin: Not test.
Relevance: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
Reference: "Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units."Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G.Virology 184:359-369(1991)
English
Deutsch
