Recombinant Human CCKAR Protein

Recombinant Human CCKAR Protein
SKU
ASBPP-4079-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P32238

Gene Name: CCKAR

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Lys241

End Site: Arg310

Coverage: 0.18

Isoelectric Point: 11

Core Sequence: KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNSSAANLMAKKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 84%, Pig - 78%, Cynomolgus monkey - 94%

Alternative gene names: CCKRA

Alternative protein names: Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R

Protein name: cholecystokinin A receptor

Full length: 428 amino acids

Entry name: CCKAR_HUMAN
More Information
SKU ASBPP-4079-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4079-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 886
Product information (PDF)
×
MSDS (PDF)
×