Note: Dry Ice fees will be extra-charged
Uniprot: Q12879
Gene Name: GRIN2A
Expression System: Escherichia coli
Molecular Weight: 11 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 90%
Start Site: Gln971
End Site: Arg1050
Coverage: 0.05
Isoelectric Point: 10
Core Sequence: QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 95%
Alternative gene names: NMDAR2A
Alternative protein names: Glutamate receptor ionotropic; NMDA 2A; GluN2A; Glutamate [NMDA] receptor subunit epsilon-1; N-methyl D-aspartate receptor subtype 2A; NMDAR2A; NR2A; hNR2A
Protein name: glutamate ionotropic receptor NMDA type subunit 2A
Full length: 1464 amino acids
Entry name: NMDE1_HUMAN
Product panel: Autoimmune Disease,Neuroscience Biomarkers
English
Deutsch
