Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt)

Glucose-dependent Insulinotropic Polypeptide (3-42) (human) (trifluoroacetate salt)
SKU
CAY36908-500
Packaging Unit
500 µg
Manufacturer
Cayman Chemical

Availability: loading...
Price is loading...
Shelf life (days): 1460.0

Formulation: A solid

Formal Name: L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-a-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-a-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-a-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-asparaginyl-L-a-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine, trifluoroacetate salt

Amino Acids: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH

Purity: ≥90%

Formula Markup: C214H324N58O63S / XCF3COOH

Formula Weight: 4749.3

Notes: Gastric inhibitory peptide 1 (GIP-1) (3-42) is a peptide fragment of the incretin hormone GIP (Item No. 25004) and a GIP receptor antagonist.{65841} It is formed from GIP by serum dipeptidyl peptidase 4 (DDP-4). GIP-1 (3-42) (100 nM) reduces insulin secretion from BRIN-BD11 pancreatic cells. It increases plasma glucose levels and decreases plasma insulin levels in an ob/ob mouse model of diabetes when administered at a dose of 25 nmol/kg.
More Information
SKU CAY36908-500
Manufacturer Cayman Chemical
Manufacturer SKU 36908-500
Package Unit 500 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download