TMEM26 antibody

Clone Name:

Calculated MW: 42

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot ID: Q6ZUK4

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: transmembrane protein 26