Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG1, kappa, Host: Human

CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: P42574

• Artikelnummer: ABAAb04219-10.0-BT
• Hersteller: Absolute Antibody
• Hersteller Artikelnummer: Ab04219-10.0-BT
• Verpackungseinheit: 1 mg
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Western Blotting, ELISA, Inhibition
• Isotyp: IgG1
• Wirt: Human