Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Monoclonal, IgG, kappa, Host: Rabbit
Artikelnummer
ABAAb04219-23.0-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: P42574
Mehr Informationen
Artikelnummer ABAAb04219-23.0-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04219-23.0-BT
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Monoclonal
Methode Western Blotting, ELISA, Inhibition
Isotyp IgG
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF) Download