Description of Target: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Key Reference: Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein.Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999).
Molecular Weight: 33.8 kDa.
Product Format: Liquid or Lyophilized powder.
Protein Name: Acid ceramidase.
Protein Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM.
Protein Size: 19-141 aa.
Purity: Greater than 90% as determined by SDS-PAGE.
Source: in vitro E. Coli expression system.
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged