Ataxin 1 Antibody, Clone N76/8: HRP

Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
Artikelnummer
STRSMC-455D-HRP
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Ataxin 1

Conjugate: HRP

Product Type: Monoclonal

Clone Number: N76/8 (Formerly sold as S76-8)

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Swiss-Prot: P54254

Purification: Protein G Purified

Storage Buffer: 73.64mM Carbonate, 54.55mM Ethanolamine, 45.45mM Cyanoborohydride, 18.18mM Sodium Hydroxide and 0.23mM Citrate in dH2O

Concentration: 1 mg/ml

Specificity: Detects ~85kDa.

Cellular Localization: Cytoplasm / Nucleus

Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Mehr Informationen
Artikelnummer STRSMC-455D-HRP
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SMC-455D-HRP
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Monoclonal
Methode Western Blotting, ELISA, Immunohistochemistry
Isotyp IgG2b
Human Gene ID 20238
Wirt Mouse
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF) Download