CBLN3 Recombinant Protein (Mouse)

Description of Target: May be involved in synaptic functions in the CNS.

Key Reference: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004).

Molecular Weight: 22.4 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Cerebellin-3.

Protein Sequence: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL.

Protein Size: 25-197 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: in vitro E. Coli expression system.

Tag: N-terminal 6xHis-tagged

• Artikelnummer: AVIOPCA05357-20
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05357-20
• Green Labware: Nein
• Verpackungseinheit: 20µg
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Human Gene ID: 56410