MEFV antibody

MEFV antibody
Artikelnummer
GTX01088-100
Verpackungseinheit
100 μg
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 86

Form: Liquid

Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]

Uniprot ID: O15553

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: MEFV innate immuity regulator, pyrin
Mehr Informationen
Artikelnummer GTX01088-100
Hersteller GeneTex
Hersteller Artikelnummer GTX01088-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Reaktivität Human, Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Isotyp IgG
Human Gene ID 4210
Wirt Rabbit
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download