NFUA Recombinant Protein (Vibrio vulnificus)

Description of Target: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.UniRule annotation.

Key Reference: Complete genome sequence of Vibrio vulnificus CMCP6.Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).

Molecular Weight: 47 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: Fe/S biogenesis protein NfuA.

Protein Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY.

Protein Size: 1-194 aa.

Purity: Greater than 90% as determined by SDS-PAGE.

Source: Mammalian cell.

Tag: C-terminal hFc-tagged

• Artikelnummer: AVIOPCA05420-500
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: OPCA05420-500
• Verpackungseinheit: 500µg
• Mengeneinheit: STK
• Reaktivität: Various species
• Human Gene ID: 2622994