NHE3 antibody

Calculated MW: 93

Form: Liquid

Buffer (with preservative): PBS, 2 % Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016]

Uniprot ID: P48764

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the middle region of human SLC9A3: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: solute carrier family 9 member A3

• Artikelnummer: GTX04975-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04975-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 6550
• Wirt: Rabbit
• Konjugat: Unconjugated