NUCB1 Antibody - C-terminal region

NUCB1 Antibody - C-terminal region
Artikelnummer
AVIP102230_T100-25
Verpackungseinheit
25µl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Description of Target: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of .-amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis. Useful for immunohistochemistry and western blot.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUCB1

Key Reference: Lin, P., et al., approved publication in the Journal of Neurochemistry. See //www.blackwell-synergy.com/loi/jnc for details (doi: 10.1111/j.1471-4159.2006.04336.x).

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Nucleobindin-1

Protein Size: 461

Purification: Protein A purified
Mehr Informationen
Artikelnummer AVIP102230_T100-25
Hersteller Aviva Systems Biology
Hersteller Artikelnummer P102230_T100-25UL
Verpackungseinheit 25µl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4924
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×