PrEST Antigen CD83

CD83 molecule

Sequence: KFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPQKTELV

GeneName: CD83

Ensembl Gene ID: ENSG00000112149

UniProt ID: Q01151

Entrez Gene ID: 9308

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000015396: 79%, ENSRNOG00000018092: 79%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST95958-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95958-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 9308
• Konjugat: Unconjugated