Recombinant Human ABHD16A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95870

Gene Name: ABHD16A

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu141

End Site: Asn410

Coverage: 0.50

Isoelectric Point: 7.5

Core Sequence: ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: BAT5; G5; NG26

Alternative protein names: Phosphatidylserine lipase ABHD16A; Alpha/beta hydrolase domain-containing protein 16A; Abhydrolase domain-containing protein 16A; HLA-B-associated transcript 5; hBAT5; Monoacylglycerol lipase ABHD16A; Protein G5

Protein name: abhydrolase domain containing 16A, phospholipase

Full length: 558 amino acids

Entry name: ABHGA_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3688-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3688-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 7920