Recombinant Human ACTG1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P63261

Gene Name: ACTG1

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gln41

End Site: Arg290

Coverage: 0.68

Isoelectric Point: 6

Core Sequence: QGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ACTG

Alternative protein names: Actin; cytoplasmic 2; Gamma-actin) [Cleaved into: Actin; cytoplasmic 2; N-terminally processed]

Protein name: actin gamma 1

Full length: 375 amino acids

Entry name: ACTG_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-347-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-347-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 71