Recombinant Human APOOL Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6UXV4

Gene Name: APOOL

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Ala161

End Site: Asp260

Coverage: 0.46

Isoelectric Point: 10

Core Sequence: AKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Pig - 79%

Alternative gene names: CXorf33; FAM121A; MIC27

Alternative protein names: MICOS complex subunit MIC27; Apolipoprotein O-like; Protein FAM121A

Protein name: apolipoprotein O like

Full length: 268 amino acids

Entry name: MIC27_HUMAN

• Artikelnummer: ASBPP-3293-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3293-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 139322