Recombinant Human ARGFX Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NJG6

Gene Name: ARGFX

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Glu81

End Site: Arg160

Coverage: 0.28

Isoelectric Point: 11.5

Core Sequence: ERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILPSKKNVPTSPR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Rat - 44%, Pig - 51%, Cynomolgus monkey - 79%

Alternative gene names: /

Alternative protein names: Arginine-fifty homeobox

Protein name: arginine-fifty homeobox

Full length: 315 amino acids

Entry name: ARGFX_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3199-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3199-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 503582