Recombinant Human ARHGAP39 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9C0H5

Gene Name: ARHGAP39

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Leu501

End Site: Gln580

Coverage: 0.08

Isoelectric Point: 7.5

Core Sequence: LCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAEGEAEGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Pig - 77%

Alternative gene names: KIAA1688

Alternative protein names: Rho GTPase-activating protein 39

Protein name: Rho GTPase activating protein 39

Full length: 1083 amino acids

Entry name: RHG39_HUMAN

• Artikelnummer: ASBPP-3285-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3285-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 80728