Recombinant Human ARTN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T4W7

Gene Name: ARTN

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ser141

End Site: Arg210

Coverage: 0.71

Isoelectric Point: 7.5

Core Sequence: SDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 96%

Alternative gene names: EVN

Alternative protein names: Artemin; Enovin; Neublastin

Protein name: artemin

Full length: 220 amino acids

Entry name: ARTN_HUMAN

Product panel: Neuroscience Biomarkers

• Artikelnummer: ASBPP-3015-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3015-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 9048