Recombinant Human BCL2L10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HD36

Gene Name: BCL2L10

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Met11

End Site: Arg180

Coverage: 0.89

Isoelectric Point: 9.5

Core Sequence: MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 47%, Pig - 55%, Cynomolgus monkey - 78%

Alternative gene names: BCL-B; BCLB; BOO; DIVA

Alternative protein names: Bcl-2-like protein 10; Bcl2-L-10; Anti-apoptotic protein Boo; Anti-apoptotic protein NrH; Apoptosis regulator Bcl-B

Protein name: BCL2 like 10

Full length: 204 amino acids

Entry name: B2L10_HUMAN

• Artikelnummer: ASBPP-3155-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3155-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 10017