Recombinant Human BEND3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T5X7

Gene Name: BEND3

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Glu11

End Site: Asn120

Coverage: 0.14

Isoelectric Point: 5

Core Sequence: EEVLKSITVKVETEAEDAALDCSVNSRTSEKHSVDSVLTALQDSSKRKQLVSDGLLDSVPGVKRRRLIPEALLAGMRNRENSSPCQGNGEQAGRGRSLGNVWPGEEEPCN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Pig - 79%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1553

Alternative protein names: BEN domain-containing protein 3

Protein name: BEN domain containing 3

Full length: 828 amino acids

Entry name: BEND3_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3154-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3154-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 57673