Recombinant Human BEST3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N1M1

Gene Name: BEST3

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Thr471

End Site: Ser640

Coverage: 0.26

Isoelectric Point: 5

Core Sequence: TIRETSQTSTLQSLTPQSSVRTSPIKMPLVPEVLITAAEAPVPTSGGYHHDSATSILSSEFTGVQPSKTEQQQGPMGSILSPSEKETPPGGPSPQTVSASAEENIFNCEEDPGDTFLKRWSLPGFLGSSHTSLGNLSPDPMSSQPALLIDTETSSEISGINIVAGSRVSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 61%, Cynomolgus monkey - 95%

Alternative gene names: VMD2L3

Alternative protein names: Bestrophin-3; Vitelliform macular dystrophy 2-like protein 3

Protein name: bestrophin 3

Full length: 668 amino acids

Entry name: BEST3_HUMAN

• Artikelnummer: ASBPP-3689-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3689-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 144453