Recombinant Human BMP2K Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NSY1

Gene Name: BMP2K

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Ser791

End Site: Thr1000

Coverage: 0.19

Isoelectric Point: 7

Core Sequence: SEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSAQLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTKAPFSKKVNVQECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFDEITGSQQQKVKQRSLQKLSSRQRRTKQDMSKSNGKRHHGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Pig - 59%, Cynomolgus monkey - 98%

Alternative gene names: BIKE

Alternative protein names: BMP-2-inducible protein kinase; BIKe

Protein name: BMP2 inducible kinase

Full length: 1161 amino acids

Entry name: BMP2K_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-10410-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10410-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 55589