Recombinant Human CCL3 Protein

Recombinant Human CCL3 Protein
Artikelnummer
ASBPP-3670-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P10147

Gene Name: CCL3

Expression System: Escherichia coli

Molecular Weight: 8.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Thr31

End Site: Leu90

Coverage: 0.95

Isoelectric Point: 5

Core Sequence: TACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 77%, Pig - 79%, Cynomolgus monkey - 94%

Alternative gene names: G0S19-1; MIP1A; SCYA3

Alternative protein names: C-C motif chemokine 3; G0/G1 switch regulatory protein 19-1; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible cytokine A3; Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69; LD78-alpha(4-69)]

Protein name: C-C motif chemokine ligand 3

Full length: 92 amino acids

Entry name: CCL3_HUMAN

Product panel: Cytokines
Mehr Informationen
Artikelnummer ASBPP-3670-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3670-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 6348
Produktinformation (PDF)
×
MSDS (PDF)
×