Recombinant Human CGGBP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UFW8

Gene Name: CGGBP1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly31

End Site: Ile140

Coverage: 0.73

Isoelectric Point: 9.5

Core Sequence: GGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 98%

Alternative gene names: CGGBP

Alternative protein names: CGG triplet repeat-binding protein 1; CGG-binding protein 1; 20 kDa CGG-binding protein; p20-CGGBP DNA-binding protein

Protein name: CGG triplet repeat binding protein 1

Full length: 167 amino acids

Entry name: CGBP1_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-10366-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10366-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 8545