Recombinant Human CWC25 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NXE8

Gene Name: CWC25

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser11

End Site: Met80

Coverage: 0.19

Isoelectric Point: 8

Core Sequence: SWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDVGAVKKKEEKLDWMYQGPGGM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 34%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: CCDC49

Alternative protein names: Pre-mRNA-splicing factor CWC25 homolog; Coiled-coil domain-containing protein 49; Spliceosome-associated protein homolog CWC25

Protein name: CWC25 spliceosome associated protein homolog

Full length: 425 amino acids

Entry name: CWC25_HUMAN

• Artikelnummer: ASBPP-10428-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10428-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 54883