Recombinant Human CYTH4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIA0

Gene Name: CYTH4

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Asn251

End Site: Ile390

Coverage: 0.38

Isoelectric Point: 8.5

Core Sequence: NDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 78%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: CYT4; PSCD4

Alternative protein names: Cytohesin-4; PH; SEC7 and coiled-coil domain-containing protein 4

Protein name: cytohesin 4

Full length: 394 amino acids

Entry name: CYH4_HUMAN

• Artikelnummer: ASBPP-3158-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3158-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 27128