Recombinant Human EXOC7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPT5

Gene Name: EXOC7

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu21

End Site: Ile200

Coverage: 0.25

Isoelectric Point: 5

Core Sequence: EEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: EXO70; KIAA1067

Alternative protein names: Exocyst complex component 7; Exocyst complex component Exo70

Protein name: exocyst complex component 7

Full length: 735 amino acids

Entry name: EXOC7_HUMAN

• Artikelnummer: ASBPP-2946-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2946-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 23265