Note: Dry Ice fees will be extra-charged
Uniprot: Q01780
Gene Name: EXOSC10
Expression System: Escherichia coli
Molecular Weight: 19.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 79%
Start Site: Pro691
End Site: Lys850
Coverage: 0.18
Isoelectric Point: 10.5
Core Sequence: PFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGK
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 77%, Pig - 82%, Cynomolgus monkey - 96%
Alternative gene names: PMSCL; PMSCL2; RRP6
Alternative protein names: Exosome complex component 10; Autoantigen PM/Scl 2; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; Polymyositis/scleroderma autoantigen 100 kDa; PM/Scl-100; Polymyositis/scleroderma autoantigen 2
Protein name: exosome component 10
Full length: 885 amino acids
Entry name: EXOSX_HUMAN
Product panel: Autoimmune Disease,DNA binding & Chromatin,Enzyme
Deutsch
English
