Recombinant Human FHDC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9C0D6

Gene Name: FHDC1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Asn991

End Site: Glu1100

Coverage: 0.10

Isoelectric Point: 11

Core Sequence: NLPRQKPEENKTCRAHSEGPESPKEEPKTPSVPSVPHELPRVPSFARNTVASSSRSMRTDLPPVAKAPGITRTVSQRQLRVKGDPEDAAPKDSSTLRRASSARAPKKRPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Pig - 68%, Cynomolgus monkey - 93%

Alternative gene names: INF1; KIAA1727

Alternative protein names: FH2 domain-containing protein 1; Inverted formin-1

Protein name: FH2 domain containing 1

Full length: 1143 amino acids

Entry name: FHDC1_HUMAN

• Artikelnummer: ASBPP-3099-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3099-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 85462