Recombinant Human FOXI2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZQN5

Gene Name: FOXI2

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Lys161

End Site: Glu240

Coverage: 0.26

Isoelectric Point: 7.5

Core Sequence: KKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 94%, Pig - 80%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Forkhead box protein I2

Protein name: forkhead box I2

Full length: 318 amino acids

Entry name: FOXI2_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3236-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3236-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 399823