Recombinant Human FSBP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95073

Gene Name: FSBP

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Gln81

End Site: Arg190

Coverage: 0.41

Isoelectric Point: 6

Core Sequence: QELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 83%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Fibrinogen silencer-binding protein

Protein name: fibrinogen silencer binding protein

Full length: 299 amino acids

Entry name: FSBP_HUMAN

• Artikelnummer: ASBPP-10363-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10363-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 100861412