Recombinant Human FSTL5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N475

Gene Name: FSTL5

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Met151

End Site: Arg240

Coverage: 0.12

Isoelectric Point: 4

Core Sequence: MLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: KIAA1263

Alternative protein names: Follistatin-related protein 5; Follistatin-like protein 5

Protein name: follistatin like 5

Full length: 847 amino acids

Entry name: FSTL5_HUMAN

• Artikelnummer: ASBPP-3138-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3138-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 56884