Recombinant Human GPX7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SL4

Gene Name: GPX7

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gln20

End Site: Leu187

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 43%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: GPX6

Alternative protein names: Glutathione peroxidase 7; GPx-7; GSHPx-7; CL683

Protein name: glutathione peroxidase 7

Full length: 187 amino acids

Entry name: GPX7_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3233-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3233-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 2882