Recombinant Human GRAMD1C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IYS0

Gene Name: GRAMD1C

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Ser181

End Site: Ser270

Coverage: 0.16

Isoelectric Point: 4

Core Sequence: SLTRQEFWQLLQQNYGTELGLNAEEMENLSLSIEDVQPRSPGRSSLDDSGERDEKLSKSISFTSESISRVSETESFDGNSSKGGLGKEES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 57%, Pig - 84%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Protein Aster-C; GRAM domain-containing protein 1C

Protein name: GRAM domain containing 1C

Full length: 662 amino acids

Entry name: ASTRC_HUMAN

• Artikelnummer: ASBPP-3678-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3678-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 54762