Recombinant Human HAVCR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96D42

Gene Name: HAVCR1

Expression System: Escherichia coli

Molecular Weight: 51 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Start Site: Phe211

End Site: Gln280

Coverage: 0.23

Isoelectric Point: 5

Core Sequence: FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 89%

Alternative gene names: KIM1; TIM1; TIMD1

Alternative protein names: Hepatitis A virus cellular receptor 1; HAVcr-1; Kidney injury molecule 1; KIM-1; T-cell immunoglobulin and mucin domain-containing protein 1; TIMD-1; T-cell immunoglobulin mucin receptor 1; TIM; TIM-1; T-cell membrane protein 1; CD antigen CD365

Protein name: hepatitis A virus cellular receptor 1

Full length: 364 amino acids

Entry name: HAVR1_HUMAN

CD Antigen: CD365

Product panel: CD Antigen

• Artikelnummer: ASBPP-354-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-354-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 26762