Recombinant Human HOXA6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P31267

Gene Name: HOXA6

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Thr51

End Site: Arg130

Coverage: 0.36

Isoelectric Point: 7

Core Sequence: TYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: HOX1B

Alternative protein names: Homeobox protein Hox-A6; Homeobox protein Hox-1B

Protein name: homeobox A6

Full length: 233 amino acids

Entry name: HXA6_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-3699-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3699-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 3203