Recombinant Human KCNT2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6UVM3

Gene Name: KCNT2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Ser561

End Site: Gly670

Coverage: 0.10

Isoelectric Point: 4.5

Core Sequence: SAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGTVAIDLQDTSCRSASGPTLSLPTEGSKEIRRPSIAPVLEVADTSSIQTCDLLSDQSEDETTPDEEMSSNLEYAKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 98%

Alternative gene names: SLICK

Alternative protein names: Potassium channel subfamily T member 2; Sequence like an intermediate conductance potassium channel subunit; Sodium and chloride-activated ATP-sensitive potassium channel Slo2.1

Protein name: potassium sodium-activated channel subfamily T member 2

Full length: 1135 amino acids

Entry name: KCNT2_HUMAN

• Artikelnummer: ASBPP-3095-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3095-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 343450