Recombinant Human KLF13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2Y9

Gene Name: KLF13

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu111

End Site: Thr220

Coverage: 0.44

Isoelectric Point: 9

Core Sequence: EGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 77%, Pig - 95%, Cynomolgus monkey - 55%

Alternative gene names: BTEB3; NSLP1

Alternative protein names: Krueppel-like factor 13; Basic transcription element-binding protein 3; BTE-binding protein 3; Novel Sp1-like zinc finger transcription factor 1; RANTES factor of late activated T-lymphocytes 1; RFLAT-1; Transcription factor BTEB3; Transcription factor NSLP1

Protein name: KLF transcription factor 13

Full length: 288 amino acids

Entry name: KLF13_HUMAN

Product panel: DNA binding & Chromatin

• Artikelnummer: ASBPP-2956-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-2956-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51621