Recombinant Human KMT5C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86Y97

Gene Name: KMT5C

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Leu101

End Site: Gly220

Coverage: 0.27

Isoelectric Point: 6.5

Core Sequence: LPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: SUV420H2

Alternative protein names: Histone-lysine N-methyltransferase KMT5C; Lysine N-methyltransferase 5C; Lysine-specific methyltransferase 5C; Suppressor of variegation 4-20 homolog 2; Su(var)4-20 homolog 2; Suv4-20h2; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; [histone H4]-lysine20 N-methyltransferase KMT5B

Protein name: lysine methyltransferase 5C

Full length: 462 amino acids

Entry name: KMT5C_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• Artikelnummer: ASBPP-10386-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10386-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 84787